Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com

  • 2022-01-07수집 일
  • 2022-02-15업데이트 됨
Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com
  • 웹 사이트 주소:www.liputan6.com
  • 서버 IP:35.190.21.225
  • 사이트 설명:Liputan6.com - Berita hari ini Indonesia dan Dunia, kabar terbaru terkini. Situs berita terpercaya dari politik, peristiwa, bisnis, bola, tekno hingga gosip artis

도메인 이름:www.liputan6.com평가

~에 대한 5000~500000

도메인 이름:www.liputan6.com흐름

197

도메인 이름:www.liputan6.com좋거나 나쁘거나

하늘에 비. 즉각적인 성공 지

웹 사이트 :Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com가중치

2

웹 사이트 :Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.comIP

35.190.21.225

웹 사이트 :Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com함유량

BeritaTerkini,KabarTerbaruHariIniIndonesiadanDunia-Liputan6.comvarliputan6_id_site_id="1";varliputan6_id_client_id="4";varliputan6_id_client_token="78ba6ed9be4cdb5b0";(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':newDate().getTime(),event:'gtm.js'});varf=d.getElementsByTName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-NSWX5MT');div.advertisement-placeholder{text-align:center;padding-bottom:20px;display:flex;flex-direction:column;justify-content:center;}div.advertisement-textp{margin:0;font-family:OpenSans;font-style:normal;font-weight:normal;font-size:10px;line-height:20px;color:#;}div.advertisement-banner{margin:0pxauto;}div#div-gpt-ad-sc-placeholder,div#div-gpt-ad-sc-ping-placeholder{min-height:270px;}div#div-gpt-ad-hp-placeholder,div#div-gpt-ad-hp2-placeholder{min-height:620px;}div#div-gpt-ad-contextual-placeholder{min-height:550px;}div#div-gpt-ad-sc-placeholderdiv.advertisement-banner{margin:0pxauto;}window.kmklabs={};window.kmklabs.env='production';window.kmklabs.baseAssetsUrl='cdn-production-assets-kly.akamaized.net/assets';window.kmklabs.gtm={"articleId":"","articleTitle":"","category":"ChannelPe","editors":"","editorialType":"","embedVideo":"","peTitle":"home","publicationDate":"","publicationTime":"","subCategory":"root","subSubCategory":"","t":"","authors":{"type":"","names":""},"numberOfWords":0,"enabled":true,"log":false,"imeCreation":false,"type":"","videos":[],"photos":[],"partner":"","isSEO":false,"reporters":"","photographers":"","isLiveReport":false,"liveReBerita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.comportT":"","audience":"","brand":"","videoSource":""};window.kmklabs.visitor={"publicationDate":"","publicationTime":"","t":[],"subCategory":"root","subSubCategory":"","type":"","peType":"ChannelPe","audience":[],"e":"","gender":"","title":"","platform":"Desktop","site":"liputan6","isAdultContent":false};window.kmklabs.platform='Desktop';window.kmklabs.peType='ChannelPe';window.kmklabs.site='liputan6';window.kmklabs.dmpSegments=[];window.gaPrefix="Liputan6";window.kmklabs.channel={"id":188,"name":"Liputan6","full_slug":""};window.kmklabs.category={"id":188,"name":"Liputan6","full_slug":""};window.kmklabs.toggle={"disableVirtualpvPhoto":false,"lip6DelayPing":false,"checkDuplicateCms":false,"cmsCheckAllT":false,"lip6NoPeLoad":true,"disableVirtualPVFimela":true};functionsetKmklabsVisitorGaId(){if(typeofga==='function'){if(typeofga.getAll=='function'){ga(function(){window.kmklabs.visitor.gaid=ga.getAll()[0].get('clientId');});}else{setTimeout(setKmklabsVisitorGaId,500);}}else{setTimeout(setKmklabsVisitorGaId,500);}}setKmklabsVisitorGaId();oneSignalInitialized=false;window.addEventListener("load",function(){if(!$||!$.fn||!$.fn.scroll){return;};$(window).scroll(function(){if(oneSignalInitialized){return;};oneSignalInitialized=true;varOneSignal=window.OneSignal||[];OneSignal.push(function(){OneSignal.init({appId:"d146d4bc-9c50-44e1-aaed-e0ba598",});});});});;window.kmklabs.featureToggle={};window.kmklabs.featureToggle.gaSendPeview=false;window.kmklabs.featureToggle.gaSendEventNative=false;window.isAutoplay=true;window.kmklabs.related_system='t';;window.gaSendEvent=function(event,category,action,label,fieldsObject){window.ga&&window.ga('kmkGATracker.send','event',category,action,label,fieldsObject);};window.clickEvent=function(category,action,label){window.ga&&window.ga('kmkGATracker.send','event',category,action,label);};div#taboola-below-article-thumbnails{padding-top:20px;padding-bottom:20px;}Suksesliputan6CARIHomeNewsHajiRamadanQuranBisnisSahamShowBizCryptoFotoTeknoCekFaktaVideoHotJatimJatengOtomotifRegionalDisabilitasGlobalOnOffSurabayaLifestyleHealthCitizen6PilkadaBolaHEADLINEHARIINIHasilKunjunganJokowikeUkrainadanRusia,MisiPerdamaianSukses?02Jul202206:00AkhirDramaMohamedSalahdiLiverpoolLiverpoolakhirnyasuksesmerayuSalaharmaubertahandiAnfieldlebihlamali.TheRedstakmaukehilanganpemainbintangnyali.BeritaUtamaLainnya02Jul202206:38WallStreetSemringahMemasukiJuli2022tapiInvestorMasihKhawatirInflasi02Jul202206:02BisaTerjadiKapanSaja,IniTipsarMobilTidakMudahTerbakar02Jul202206:002Juli2005:RilisLive8,KonserBintangMusikTerkenaluntukPerangiKemiskinanAfrika02Jul202205:412PetinjuIndonesiaRaihKemenanganKOatasJoanThailand02Jul202205:00AksiHeroikTNISelamatkanOrangUtanAkibatBanjirdiKotawaringinBarat01Jul202220:15FOTO:MomenRomantisHamishDaudTemaniRaisaManggung01Jul202219:28VIDEO:JordiAmatResmiDianugerahiGelarPangeran$(document).ready(function(){$("#div-gpt-ad-liputan6-middle").css({"margin-top":"30px","margin-bottom":"30px"});});TJAHJOKUMOLOMENINGGALIstriTjahjoKumolo:BapakInginMeninggaldalamTugasTop3:PerjalananKarierTjahjoKumoloSemasaHidupKenanganKeponakanPenungguRumahKeluargaSebulanSebelumTjahjoKumoloMeninggalDoaMenakerIdasambilMengenalSosokTjahjoKumoloMelayatkeRumahDuka,SriMulyaniBeriDukunganMorilkeIstriTjahjoKumoloTop3BeritaHariIni:3ResepAsem-AsemDinguntukSiap-SiapMerayakanIdulAdha20226PotretKenanganDetriWarmantoBersamaMendiangAyahMertuanya,TjahjoKumoloMenpanRBTjahjoKumoloMeninggalDunia,KeluargaBesarPLNBerdukaTjahjoKumoloMeninggalDunia,SerikatBuruhBerdukaMengenangMenpanRBTjahjoKumolodiMataParaSahabat .channel-ad_ad-no{ height:0px; overflow:hidden;}InfografisInfografisCaraDaftar-BeliPertalitedanSolarSubsidiPakaiMyPertaminaMulai1Juli2...Adacarabarumembelipertalitedansolarsubsidi.UjicobapendaftaranpembelianBBMbersubsidiinimelaluisistemMyPertaminamulai1Juli2022.Berlakuuntukpemilikkendaraanrodaempat.BolaBolaGanjil:EksistensiBirminghamCity,SekedarMengejarPromosiKastatertinggimerupakantanahimpianbiklubsepakbola.Partisipasidisanamembukaberbaikesempatan,mulaiekonomihinggaharkat.SimakperjuanganrutinBirminghamCitymencapaileveltersebut.InfografisInfografisVaksinasiPMKHewanTernakDigencarkanJelangIdulAdhaPenyakitMulutdanKukuatauPMKtelahmenyerang297.029ekorhewanternak.VirusPMKmenyebardi19provinsidan222kabupatenmaupunkotadiseluruhIndonesia,denganjumlahkematianhewanternak1.768ekor.Peristiwa02Jul202206:52IstriTjahjoKumolo:BapakInginMeninggaldalamTugasErniGuntarti,istridariMenpanRBTjahjoKumolo,mengungkapkankebiasaanbaiksuaminyasebelummeninggal.Apaitu?Peristiwa02Jul202206:333FaktaTerkaitPenemuanJasadMengambangdiKaliPesanggrahan,TerdugaPelakuDitangkapTerdugapelakupembunuhanyangjasadnyaditemukanmengambangdiKaliPesanggrahan,KebayoranLama,JakartaSelatanpadaSelasa28Juni2022akhirnyaterungkap.Bisnis02Jul202206:30Top3:PerjalananKarierTjahjoKumoloSemasaHidupMenteriPendayunaanAparaturNegaradanReformasiBirokrasi(PAN-RB)TjahjoKumolomeninggalduniapadaJumat(1/7/2022)kemarin.Peristiwa02Jul202206:17CuacaHariIniSabtu2Juli2022,CerahBerawanSelimutiJakartahinggaMalamNantiMemasukiakhirpekan,cuacacerahberawanjugakompakmenaungikeempatkotapenyanggaJakarta,yaituDepok,Bogor,BekasidanTangerang.Surabaya02Jul202206:06SiswiSMAN2BanyuwangiWakiliJatimJadiPaskibrakaNasionaldiIstanaNegaraBupatiBanyuwangiIpukFiestiandanimengundangAyumiPutriSasaki,pelajarSMAN2TarunaBhayangkarayangmewakiliProvinsiJawaTimurditingkatnasionalsebaianggotaPaskibrakaNasional.IndonesiaJadiAspriKayadiIndonesia,PotretBennyJanahAsistenHotmanParisDalamBalutanBarangBranded.DuniaPeringatanBuatAnda,PembajakKontenPremierLeuedanPialaDunia2022QatarBakalDipolisikanVidioLifestyleJanganSampaiMasalahGigidanMulutMenggangguMomenPentingIni,MasihMalasMelakukanPerawatan?Culinary02Jul202206:063ResepSateDing,BumbuMerahsampaiPakaiKelapaSatedingmemangbukanhidanganyangasingbikebanyakanorangIndonesia,tapibukanberartiAndahanyabisamemakannyadenganresepyangitu-itusaja.JawaTengah-DIY02Jul202206:00CaraSeruMenontonSepakBolaSambilMenikmatiDestinasiWisataDaerahBanyakcaradilakukanuntukmenikmatipertandingansepakbola,terlebihketikatimyangkitadukungberadadiluarkota.Nah,ketikakaliantengahmenontonlatimkaliandiluarkota,kalianbisamenghubungilayananturarbisamemanfaatkanwaktusembariberliburdidaerahtersebut.Jateng02Jul202206:00GanjarTakjubAdaPetaniBegituMenjiwaisaatNyanyikanLuIndonesiaRayaadamomenunikterjadisaatpembukaanacara.PadasaatsemuayanghadirmenyanyikanluIndonesiaRaya,Ganjarmelihatdikejauhanseorangpetanibegituhikmatdanberdiritegapdalamsikapsempurna,ikutmenyanyikanlukebangsaantersebutCrypto02Jul202206:00HargaKriptoRontok,MasihMenarikJadiInvestasi?NailulHudamenjelaskankriptomasihbisamenjadialternatifasetyangmenarikbiparainvestor,khususnyainvestormuda. .channel-ad_ad-no{ height:0px; overflow:hidden;}Mom&Kids02Jul202206:006CaraBantuAnakMemahamiKeberadaanOrangtuayangTelahMeninggalDuniaMenjelaskanpadaanakkecilsoalkeberadaanorangtuanyayangtelahmeninggalduniabisajadihalyangmembingungkan.Megapolitan02Jul202205:25WubDKIAkanAktifkanLiHelipaddanLandasanPesawatdiPulauPanjangPemprovDKIJakartaberencanamengaktifkanlihelipaddanlandasanpesawatyangterbengkalaidiPulauPanjang,KepulauanSeribu.HelipaddiPulauPanjangitusempatdisebutilegalolehKetuaDPRDDKI.Megapolitan02Jul202204:34PoldaMetroJayaTangkapPelakuTutupJalanAsiaAfrikaSenayanuntukBalapLiarKepolisiantelahmenangkappelakuyangmenutupruasJalanAsiaAfrika,Senayan,JakartaPusatuntukaksibalapliarmobil.Aksitersebutsempatmemicukemacetandisekitarlokasi.Trel02Jul202204:03BhutanSegeraSambutTurisAsinguntukPertamaKaliSejakPandemiCOVID-19BhutanakanmenaikkanpajakturissaatdibukakembalitahuninijadisekitarhampirRp3jutaperwisatawanpermalam.FotoPilihanFOTO:MomenRomantisHamishDaudTemaniRaisaManggung4FOTO:ProsesiPemakamanMenpanRBTjahjoKumolodiTMPKalibata12FOTO:PemakamanMenpanRBTjahjoKumoloDihadiriSejumlahTokoh12FOTO:WapresMa'rufAminMelayatMenpanRBTjahjoKumolo6FOTO:PersemayamandanPelepasanJenazahMenpanRBTjahjoKumolo8FOTO:6PotretEksotishninyHaque,BintangFilmMencuriRadenSaleh6Jateng02Jul202204:00ModusMantanTKWHongkongTipuRibuanOrangInvestasiKriptohinggaRp200MiliardiKebume...RibuankorbanmenyenyetorinvestasikriptodiKantorPlanTitipTradingPTTFitriCryptoyangberalamatdiDesaSitiadiKecamatanPuring,KebumenhinggasenilaiRp200miliarSulawesi02Jul202204:00DilaporkanHilang,JenazahIRTMakassarDitemukanMembusukdiDalamKarungIRTtersebutternyatadibunuholehpasangansuamiistriyangtaklainadalahtetangganyasendiri.Megapolitan02Jul202203:31EksKadesdiPakuhajiTangerangJadiBuronKasusKorupsiMobilDinasKejaksaanNegeriKabupatenTangerangmenjadikanmantanKadesBonisari,KecamatanPakuhajibernamaSutisnabuBerita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.comronkasusdugaankorupsipengadaanmobiloperasionaldesa.Sulawesi02Jul202203:00DidugaDepresi,SeorangWargaBinaanLapasBoalemoNekatAkhiriHidupWargabinaantersebutnekatmengakhirihidupnyadengancaragantungdiripadaJumat(1/7/2022).VideoPilihan01:24VIDEO:ViralKeluarga'Piknik'diRumahSakit,NgulekSambaldiKamarPasienIkatankeluargayangeratsulituntukdilepaskan,bahkansaatkesusahan.Sepertibaru-baruiniviraldisebuahrumahsakit.Sejumlahorangduduklesehandanmembawabekalbaikanpiknik,sembarimenungguipasiendikamarrawat.02:10VIDEO:KenaliCiri-Ciri,JenisdanCaraMengatasiBeritaHoaks01:36VIDEO:CekBeritaHoaksdenganMudahMelaluiChatbotWhatsAppLiputan6CekFakta03:18VIDEO:JenazahMenpanRBTjahjoKumoloDibawakeWidyaChandra01:37VIDEO:TigaGeraiHolywingsTutupSaatDidemo,BuntutPromoAlkoholuntukNamaMuhammaddanMariaMegapolitan02Jul202202:23WaliKotaDepokAngkatBicarasoal4UstazDidugaCabuliSantridiWilayahnyaPolisitengahmengusutkasusdugaanpencabulandiKotaDepokyangmelibatkanempatoknumustazterhadapsejumlahsantrinya.Sumatera02Jul202202:00Gadis15TahundiAcehHamilUsaiDiperkosaKenalanDekatBerkali-kaliGadisdiAcehinidiperkosaolehseorangpemudaasalAcehBesar.Simakberitanya:Megapolitan02Jul202201:15WubDKISebutBORRSCovid-19diJakartaNaikJadi14PersenWubDKIAhmadRizaPatriamengakuiadapeningkatankasusCovid-19diJakarta.Saatini,tingkatketerpakaiantempattiduratauBORRSCovid-19diJakartamencapai14persen.Jateng02Jul202201:00KenanganKeponakanPenungguRumahKeluargaSebulanSebelumTjahjoKumoloMeninggalpolitikusPDIPtersebutterakhirkalipulangkerumahdiSemarangsekitarsebulanlaluRegional02Jul202200:20OsoUngkapPRdanJurusMemperjuangkanHidupPetaniOSOMintaHKTISeriusPerjuangkanHidupPetani.Peristiwa02Jul202200:15KemnakerDorongInformasiPasarKerjaBerikanDampakBesarBiSektorUMKMkitaoptimiskedepandapatmemilikiforecastingdemandtenakerjayangtepat,sehinggadapatmempersiapkansupplytenakerjalebihdini.Surabaya02Jul202200:06SukaDukaPensiunanGuruSDNSurabayaMenantiGajike-13CairNenekyangmemilikiempatorangcucuinimengatakan,dirinyaakhirnyamendapatkankabargembirabahwagajike-13cairpadahariJumat(1/7/2022).Peristiwa02Jul202200:05DoaMenakerIdasambilMengenalSosokTjahjoKumoloMenteriKetenakerjaan,IdaFauziyahmenyampaikandukacitayangmendalamataswafatnyaMenteriPendayunaanAparaturNegaradanReformasiBirokrasi(Menpan-RB),TjahjoKumolo.Rajut02Jul202200:03DesasDesusPengunduranDiriLiliPintaulidariKPKBahkandisebutkansuratpengundurandiriLiliPintauliitusudahdilayangkankepadaKetuaKPKFirliBahuri.Sejauhmanafaktadarikabarburungtersebut?Internasional02Jul202200:02HEADLINE:HasilKunjunganJokowikeUkrainadanRusia,MisiPerdamaianSukses?Membawamisiperdamaian,PresidenJokowimenemuiPresidenUkrainaVolodymyrZelenskydiKievdanPresidenRusiaVladimirPutindiMoskow.Peristiwa02Jul202200:00IndonesiaDorongKerjaSamaPenempatandanPelindunganPMIdenganRepublikKoreaJikamembahaspenempatanPMIinisangatvariatifdanberbeda-beda.Jateng02Jul202200:00UjiCobaMyPertaminaBanjirKeluhanWarganet,RatingBintang1diGooglePlayStoreMendom...Regulasiujicobapembelianbahanbakarminyak(BBM)subsidiPertalitedanSolardenganMyPertaminadi11daerahmulaiditerapkanhariini,Jumat(1/7/2022).Baruharipertamaditerapkan,aplikasiMyPertaminadikeluhkanolehsejumlahwarganet.JawaTengah-DIY02Jul202200:00PemkabBloraRalatSuratEdaranAjakanSalatSubuhBerjemaahPemerintahKabupaten(Pemkab)Blora,JawaTengah,mengeluarkanralatundangansalatsubuhberjemaah.Megapolitan01Jul202223:50PresidenJokowidanRombonganKembalike IndonesiadariAbuDhabiUEAPresidenJokowimengakhirilawatannyakeempatnegarasahabat.Malamini,JokowidanrombonganbertolakkeTanahAirdariAbuDhabi,UEA.Peristiwa01Jul202223:15JokowidanPresidenMBZTekenKesepakatanIndonesia-UAECEPAPresidenJokowibersamasejumlahmenterinyamelakukanpertemuanbilateraldenganPresidenMBZdanpejabatUEAdiAbuDhabi.Saham01Jul202223:05KrakatauSteelBakalRightsIssueuntukBayarUtangRp7,8TriliunPTKrakatauSteel(Persero)Tbk(KRAS)akanrightsissuedanmintarestuDPRseiringadadilusikepemilikansahamperseroanolehDPR.Surabaya01Jul202223:03MembedahKonflikrariadiBanyuwangidalamBukuKemelutTanahHutanSetidaknyaadalimababdalambuku'KemelutTanahHutan'.Edisedikitmenjelaskanbeberapababyangadadibukuitu.Sulawesi01Jul202223:00MemilikiVisiDaerahDigital,BupatiBonebolDorongPenggunaanTandaTanganManualBahkanKabupaten(Bonebol),membuktikankeseriusandalampenerapanTandaTanganElektronik(TTE)dalammewujudkan100persendigitalisasipelayanandaerah.Sejarah01Jul202223:00FlashbackPialaDunia1982,SaatBekKiriJuventusSukses"Kantongin"MaradonadanZicoDalamlaitu,legendaArgentina,DiegoMaradonaseakantakterlihatperannya.NamaMaradonaseakandikantonginolehCabrini,pasalnyapermainanyangsolidmembuatsanglegendaArgentinasulitmengembangkanpermainan.Ekonomi01Jul202222:47HapusKemiskinanEkstrem,PUPRBangunInfrastrukturdiPulauNiasKementerianPekerjaanUmumdanPerumahanRakyat(PUPR)melakukanpembangunansejumlahinfrastrukturdiPulauNias.LigaIndonesia01Jul202222:46HasilPialaPresiden2022:PSSSlemankeSemifinalUsaiKalahkanPersibLewatAduPenaltiPSSSlemanloloskesemifinalusaikalahkanPersibBandunglewatdramaadupenaltidiperempatfinalPialaPresiden2022Internasional01Jul202222:45BendaSeniIndonesiaJadiKoleksiBarudiMuseumSeniRigaBourseLatviaMuseumSeniRigaBoursediLatviamendapatkankoleksibarubendasenidariIndonesia.Saham01Jul202222:42MantanDirjenPajakFuadRahmanyJadiKomisarisUtamaKSEIFuadRahmanyterpilihsebaiKomisarisUtamamenggantikanRahmatWaluyantodalamjajaranDewanKomisarisKSEI.Sports01Jul202222:28KualifikasiFIBAWorldCup2023:IndonesiaKalahDramatisdariArabSaudiIndonesiakalahtipis67-69saatmenjamuArabSaudi.PadahaldilainiIndonesiaterusunggulhinggadetikakhirkuartertiga.Megapolitan01Jul202222:22PemprovDKIJakartaGelarSholatIdulAdha1443HdiJISPemprovDKIJakartakembalimenggelarsholatiddiJakartaInternationalStadium(JIS),JakartaUtara.SholatIdulAdha1443HakandigelarpadaMinggu,10Juli2022pukul07.00WIB.Surabaya01Jul202222:0990PersenMaterialLumpurdiJalurErek-ErekIjenSudahDibersihkanPembersihanmateriallongsordijalurErek-ErekIjensudahmencapai90persen.DiperkirakanjalurpenghubungBondowoso-Banyuwangiitubisasegeranormal.Corner01Jul202222:05UpdateCovid-19Jumat,1Juli2022:PositifBertambah2.049danSembuh1.921DatahariansebaranCovid-19per1Juli2022,kasusbarubertambah2.049menjadi6.090.509.Kasussembuhjugabertambah1.921sehinggaakumulasinyamenjadi156.740.Ekonomi01Jul202222:02MelayatkeRumahDuka,SriMulyaniBeriDukunganMorilkeIstriTjahjoKumoloMenteriKeuanganSriMulyaniIndrawatiturutberdukacitaatasmeninggalnyaMenteriPendayunaanAparaturNegaradanReformasiBirokrasi(Menpan-RB),TjahjoKumolo.Bisnis01Jul202222:02JadiKorbanPHK,MantanBuruhdiKarawangKiniBukaRumahMakanPresidenKonfederasiSerikatPekerjaSeluruhIndonesia(KSPSI)AndiGaniNenaWeabersamaKapolresKarawangAKBPAldiSubartono meresmikanUsahaMikro,Kecil,danMenengah(UMKM)LigaInternasional01Jul202222:00PesepakBolaTertuadalamSejarahPialaDuniaJelangQatar2022BerikutpesepakbolatertuayangpernahbermainpadaPialaDunia.TidakadanamaCristianoRonaldodanLionelMessi.Culinary01Jul202222:00Top3BeritaHariIni:3ResepAsem-AsemDinguntukSiap-SiapMerayakanIdulAdha2022Selainresepasem-asemding,Top3BeritaHariInijugatentangStrangerThingsSeason4Volume2danrekamkenanganmendiangMenpanRBTjahjoKumolo.Sulawesi01Jul202222:00CapaiTargetPembangunan,RSJantungSulawesiTenggaraBakalJadiRujukanNasionalSebelumdijadwalkantuntasOktober2022,RSJantungOputaYiKooSulawesiTenggarasetinggi17lantaisudahmelebihitargetpembangunan75persen.Jateng01Jul202222:00PenyebabBanyakWargaJatengJadiKorbanPinjoldanInvestasiBodong,TermasukBanyumasda...OtoritasJasaKeuangan(OJK)JawaTengahdanDIYmengakuimasihbanyakmenerimaaduaninvestasibodongdanpinjamanonline(pinjol)ilegalBisnis01Jul202221:51KPPUDimintaGunakanHakInisiatifUsutKasusUsahaAirMinumIsiUlangKomisiPengawasPersainganUsaha(KPPU)dimintauntuklebihaktifdalamwacanapelabelanBPApadakemasangalongunaulang.Energi&Tambang01Jul202221:45PertaminaTransKontinentalDukungIndustriPencariMigasPenuhiTKDNPTPertaminaTransKontinental(PTK)berkomitmenmendukungkegiatanoperasihuluminyakdangasbumi(migas),dengantetapmenjakomponenTingkatKandunganDalamNegeri(TKDN).Bisnis01Jul202221:43InstitutTeknologiPLNDipercayaPemerintahDaerahKembangkanSDMInstitutTeknologiPLN(ITPLN)kerjasamadenganPemerintahKabupatenGowadalampengembanganSDMPeristiwa01Jul202221:42BertemuPresidenUEAMBZdiIstana AlShatie,JokowiBahasSejumlahKerjaSamaPresidenJokowimelakukanpertemuanbilateraldenganPresidenUEASheikhMohamedbinZayedbinSultanAlNahyanatauMBZdiIstanaAlShatie,AbuDhabi.Saham01Jul202221:37SaraswantiIndolandDevelopmentPatokHargaIPORp200perSahamPTSaraswantiIndolandDevelopmentTbkmenawarkansebanyak340jutasahambiasadalamrangkaIPO.CekFakta01Jul202221:33VIDEOCEKFAKTA:KabarBankTih150RibuRupiahuntukBiayaTransaksi01:15Energi&Tambang01Jul202221:32SuntikanGasBumiGasEnergiBangkitkanIndustridariHantamanPandemiPTGasEnergiIndonesia(Gas)berkomitmenmendukungSubholdingGasPertaminadalammengintegrasikaninfrastrukturgasbumidiIndonesiadanmemperluasaksesenergibersihbimasyarakat.IndeksBeritaTOPIKPOPULER#TjahjoKumoloMeninggal#PialaPresiden2022#MalaysiaOpen2022#MyPertamina#COVID-19SPECIALCONTENTAncamanKrisisPanganNyata,BaimanaAntisipasinya?Journal:NasibTenaHonoreryangTakPernahMenentuCeritaPengabdianTenaHonorerSelama17TahunBerharapJadiPNSAdvertisementAdvertisementPHOTOSTORYFOTO:ProsesiPemakamanMenpanRBTjahjoKumolodiTMPKalibataFOTO:PemakamanMenpanRBTjahjoKumoloDihadiriSejumlahTokohFOTO:JenazahMenpanRBTjahjoKumoloTibadiRumahDinasCEKFAKTA01:15VIDEOCEKFAKTA:KabarBankTih150RibuRupiahuntukBiayaTransaksiBanyakHoaksTerkaitCuacaEkstrem,MasyarakatDimintaLebihTelitiTerimaInformasiKumpulanHoaksPernyataanKontroversialCEOPfizerAlbertBourlaPopulerLihatSemua1PeristiwaMenpanRBTjahjoKumoloMeninggalDunia2PeristiwaCakImin:TjahjoKumuloSeniordanSahabatBaikku3PeristiwaMenteriPANRBTjahjoKumoloMeninggalDunia4KalimantanGempaMnitudo5,0GuncangKetapangKalbar5SurabayaTjahjoKumoloWafatHariJumat,Khofifah:PenandaKebaikan6SurabayaIndeksDemokrasiJatimCapai81,31Poin,MasihKalahSamaDKIJakarta7Surabaya7LokasiPenjualanHewanKurbandiKotaBatu8SurabayaSurabayaKokohdiPuncakKlasemenPorprovJatim2022,KotaMalangMenyodokKedua9NewsVIDEO:JenazahMenpanRBTjahjoKumoloDibawakeWidyaChandra10SurabayaCegahBanjirdanLongsor,JalurWisataKawahIjenDitanami7.600Pohon11PeristiwaMengenangMenpanRBTjahjoKumolodiMataParaSahabat12Peristiwa6HalTerkaitHasilPertemuanJokowidanPutin13InfografisInfografisVaksinasiPMKHewanTernakDigencarkanJelangIdulAdha14EkonomiMelayatkeRumahDuka,SriMulyaniBeriDukunganMorilkeIstriTjahjoKumolo15PeristiwaErickThohirSebutJokowiBertemuPengusahadiUAE,SempatSinggungsoalIKN16Surabaya90PersenMaterialLumpurdiJalurErek-ErekIjenSudahDibersihkanAdvertisementKontakDisclaimerFormPengaduanRedaksiTentangKamiPedomanMediaSiberKarirKodeEtikMetodeCekFaktaSitemapHakJawabDanKoreksiBeritaJaringanLiputan6.comBola.comBola.netBrilio.netFamous.idFimela.comKapanLi.comMerdeka.comOtosia.comDream.co.id©2022liputan6.comKLYKapanLiYouniverseAllRightsReservedfunctionjsFCPInitializator(){if(typeofliputan6!=='undefined'){liputan6.init();if(liputan6.categories){ if(liputan6.categories.init){liputan6.categories.init();} if(liputan6.categories.init_show){liputan6.categories.init_show();}}if(liputan6.final){liputan6.final();};}else{setTimeout(jsFCPInitializator,500);}}ready(function(){jsFCPInitializator();});grunticon(["cdn-production-assets-kly.akamaized.net/builds/liputan6-icons.data.svg.44f5b837.css","cdn-production-assets-kly.akamaized.net/builds/liputan6-icons.data.png.0b94b8a1.css","cdn-production-assets-kly.akamaized.net/builds/liputan6-icons.fallback.4cc76e40.css"]);window.ahoyUserDefinedConfig={sendBatch:true,environment:'production',plentyHostnameProduction:'cdp.vidio.com',plentyHostnameSting:'cdp.int.vidio.com'};varurlParams=newURLSearchParams(window.location.search);/*CHANNEL*/vargpt_gam_ver='V06-DK';gpt_gam_site=window.location.hostname.toUpperCase();gpt_gam_ver=(typeofgpt_gam_site!=='undefined')?gpt_gam_ver.toUpperCase():'V.0.1';/**START-PREBIDFUNCTIONLIST*/functionspotxOutstreamFunc(bid){functionmobileAndTabletcheck(){varcheck=false;(function(a){if(/(android|bb\d+|meego).+mobile|antgo|bada\/|blackberry|blazer|compal|elaine|fennec|hiptop|iemobile|ip(hone|od)|iris|kindle|lge|maemo|midp|mmp|mobile.+firefox|netfront|operam(ob|in)i|palm(os)?|phone|p(ixi|re)\/|plucker|pocket|psp|series(4|6)0|symbian|treo|up\.(browser|link)|vodafone|wap|windowsce|xda|xiino|android|ipad|playbook|silk/i.test(a)||/1207|6310|6590|3gso|4thp|50[16]i|770s|802s|awa|abac|ac(er|oo|s\)|ai(ko|rn)|al(|ca|co)|amoi|an(ex|ny|yw)|aptu|ar(ch|go)|as(te|us)|attw|au(di|\m|r|s)|an|be(ck|ll|nq)|bi(lb|rd)|bl(ac|az)|br(e|v)w|bumb|bw\(n|u)|c55\/|capi|ccwa|cdm\|cell|chtm|cldc|cmd\|co(mp|nd)|craw|da(it|ll|ng)|dbte|dc\s|devi|dica|dmob|do(c|p)o|ds(12|\d)|el(49|ai)|em(l2|ul)|er(ic|k0)|esl8|ez([47]0|os|wa|ze)|fetc|fly(\|_)|g1u|g560|gene|gf\5|g\mo|go(\.w|od)|gr(ad|un)|haie|hcit|hd\(m|p|t)|hei\|hi(pt|ta)|hp(i|ip)|hs\c|ht(c(\||_|a|g|p|s|t)|tp)|hu(aw|tc)|i\(20|go|ma)|i230|iac(|\|\/)|ibro|idea|ig01|ikom|im1k|inno|ipaq|iris|ja(t|v)a|jbro|jemu|jigs|kddi|keji|kgt(|\/)|klon|kpt|kwc\|kyo(c|k)|le(no|xi)|lg(g|\/(k|l|u)|50|54|\[aw])|libw|lynx|m1\w|m3ga|m50\/|ma(te|ui|xo)|mc(01|21|ca)|m\cr|me(rc|ri)|mi(o8|oa|ts)|mmef|mo(01|02|bi|de|do|t(\||o|v)|zz)|mt(50|p1|v)|mwbp|mywa|n10[02]|n20[23]|n30(0|2)|n50(0|2|5)|n7(0(0|1)|10)|ne((c|m)\|on|tf|wf|wg|wt)|nok(6|i)|nzph|o2im|op(ti|wv)|oran|owg1|p800|pan(a|d|t)|pdxg|pg(13|\([18]|c))|phil|pire|pl(ay|uc)|pn\2|po(ck|rt|se)|prox|psio|pt\g|qa\a|qc(07|12|21|32|60|\[27]|i\)|qtek|r380|r600|raks|rim9|ro(ve|zo)|s55\/|sa(ge|ma|mm|ms|ny|va)|sc(01|h\|oo|p\)|sdk\/|se(c(\|0|1)|47|mc|nd|ri)|sgh\|shar|sie(\|m)|sk\0|sl(45|id)|sm(al|ar|b3|it|t5)|so(ft|ny)|sp(01|h\|v\|v)|sy(01|mb)|t2(18|50)|t6(00|10|18)|ta(gt|lk)|tcl\|tdg\|tel(i|m)|tim\|t\mo|to(pl|sh)|ts(70|m\|m3|m5)|tx\9|up(\.b|g1|si)|utst|v400|v750|veri|vi(rg|te)|vk(40|5[03]|\v)|vm40|voda|vulc|vx(52|53|60|61|70|80|81|83|85|98)|w3c(\|)|webc|whit|wi(g|nc|nw)|wmlb|wonu|x700|yas\|your|zeto|zte\/i.test(a.substr(0,4)))check=true;})(nigator.userent||nigator.vendor||window.opera);returncheck;}varbMobile=mobileAndTabletcheck();if(bMobile){varplayerWidth=300;varplayerHeight=169;}else{varplayerWidth=640;varplayerHeight=360;}constvideoDiv=bid.adUnitCode;letscript=window.document.createElement("script");script.type="text/jascript";script.src="//cdn.spotxcdn.com/website/integration_test/media/asia/EASI.js";script.setAttribute("data-spotx_channel_id",""+bid.channel_id);script.setAttribute("data-spotx_vast_url",""+bid.vastUrl);script.setAttribute("data-spotx_content_width",playerWidth);script.setAttribute("data-spotx_content_height",playerHeight);script.setAttribute("data-spotx_content_pe_url",bid.renderer.config.content_pe_url);script.setAttribute("data-spotx_ad_unit","incontent");script.setAttribute("data-spotx_autoplay","1");script.setAttribute("data-spotx_continue_out_of_view","1");script.setAttribute("data-spotx_content_container_id",videoDiv);varvid_contain=window.document.getElementById(videoDiv);vid_contain.style.cssText="display:none;margin-bottom:20px";vid_contain.appendChild(script);}/**END-PREBIDFUNCTIONLIST*//**START-PREBIDINITIATECLASS*/classPrebidInstantiate{constructor(timeout,fstimeout,hbtimeout,adunitDisplay,adunitVideo,price){this.PREBID_TIMEOUT=timeout;this.FAILSAFE_TIMEOUT=fstimeout;this.HB_TIMEOUT=hbtimeout;this.ADUNITDISPLAY=adunitDisplay;this.ADUNITVIDEO=adunitVideo;this.PRICE=price;this.pushBid();this.failsafePrebid();}failsafePrebid(){letthat=this;setTimeout(function(){that.initAdserver();},this.FAILSAFE_TIMEOUT);}pushBid(){pbjs.que.push(()=>{pbjs.addAdUnits(this.ADUNITDISPLAY);pbjs.addAdUnits(this.ADUNITVIDEO);pbjs.setConfig({priceGranularity:this.PRICE,enableSendAllBids:true,cache:{url:'prebid.adnxs.com/pbc/v1/cache'},//bidderTimeout:2000,});pbjs.requestBids({bidsBackHandler:this.initAdserver,timeout:this.PREBID_TIMEOUT,});});}initAdserver(){if(pbjs.initAdserverSet)return;pbjs.initAdserverSet=true;//GetalloftheadUnitcodesforthedisplayadUnitsvardisplayAdUnitCodes=[];adUnitsDisplay.forEach(function(adUnit){displayAdUnitCodes.push(adUnit.code);//console.log(adUnit.code);});googlet.cmd.push(function(){pbjs.que.push(function(){pbjs.setTargetingForGPTAsync(displayAdUnitCodes);googlet.pubads().refresh([window.GAMLibrary.showcase]);googlet.pubads().refresh([window.GAMLibrary.halfpe1]);googlet.pubads().refresh([window.GAMLibrary.halfpe2]);googlet.pubads().refresh([window.GAMLibrary.leaderboard]);}Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com);});}}/**START-PREBIDINITIATECLASS*//**START-PREBIDINIT,CONFIGURATION&GOOGLEINIT*/constpriceGranularityConfig={buckets:[{precision:2,min:0.02,max:2.99,increment:0.01},{precision:2,min:3,max:10,increment:0.1},],};vargptadslots=[];vargooglet=googlet||{};varpbjs=pbjs||{};varadUnitsDisplay=[{code:"div-gpt-ad-liputan6-sc",mediaTypes:{banner:{sizes:[[300,250],[250,250],],},},bids:[{bidder:"innity",params:{zone:,pub:539}},{bidder:"teads",params:{peId:,placementId:}},{bidder:"grid",params:{uid:,bidFloor:0.2}},{bidder:'pubmatic',params:{publisherId:'',adSlot:'Prebid-Liputan6-Mobile-300x250'}},{bidder:'unruly',params:{siteId:}},{bidder:'medianet',params:{cid:'8CUWX4UX4',crid:'1'}},{bidder:'smartadserver',params:{domain:'prg-apac.smartadserver.com',networkId:4221,siteId:,peId:,formatId:}}, {bidder:"openx",params:{delDomain:"emtek-d.openx.net",unit:"9"}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-halfpe1",mediaTypes:{banner:{sizes:[[300,250],[300,600],[160,600],],},},bids:[{bidder:"innity",params:{zone:,pub:536}},{bidder:"teads",params:{peId:,placementId:}},{bidder:"grid",params:{uid:,bidFloor:0.2}},{bidder:'pubmatic',params:{publisherId:'',adSlot:'Prebid-Liputan6-Mobile-300x600'}},{bidder:'unruly',params:{siteId:}},{bidder:'medianet',params:{cid:'8CUWX4UX4',crid:'2'}},{bidder:'smartadserver',params:{domain:'prg-apac.smartadserver.com',networkId:4221,siteId:,peId:,formatId:}}, {bidder:"openx",params:{delDomain:"emtek-d.openx.net",unit:"3"}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-halfpe2",mediaTypes:{banner:{sizes:[[300,250],[300,600],[160,600],],},},bids:[{bidder:"innity",params:{zone:,pub:536}},{bidder:"teads",params:{peId:,placementId:}},{bidder:"grid",params:{uid:,bidFloor:0.2}},{bidder:'pubmatic',params:{publisherId:'',adSlot:'Prebid-Liputan6-Mobile-300x600'}},{bidder:'unruly',params:{siteId:}},{bidder:'medianet',params:{cid:'8CUWX4UX4',crid:'2'}},{bidder:'smartadserver',params:{domain:'prg-apac.smartadserver.com',networkId:4221,siteId:,peId:,formatId:}}, {bidder:"openx",params:{delDomain:"emtek-d.openx.net",unit:"3"}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-lb",mediaTypes:{banner:{sizes:[[728,90],[970,90],[970,250],],},},bids:[{bidder:'smartadserver',params:{domain:'prg-apac.smartadserver.com',networkId:4221,siteId:,peId:,formatId:}},{bidder:'ix',params:{siteId:''}},],},];varadUnitsVideo=[{code:"div-gpt-ad-liputan6-sc",mediaTypes:{video:{playerSize:[300,250],//Notsetsothattheplayercanberepsonsivecontext:"outstream",protocols:[2,3,7]},},bids:[{bidder:"spotx",params:{channel_id:,ad_unit:"outstream",outstream_function:spotxOutstreamFunc}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-halfpe1",mediaTypes:{video:{playerSize:[300,600],//Notsetsothattheplayercanberepsonsivecontext:"outstream",protocols:[2,3,7]},},bids:[{bidder:"spotx",params:{channel_id:,ad_unit:"outstream",outstream_function:spotxOutstreamFunc}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-halfpe2",mediaTypes:{video:{playerSize:[300,600],//Notsetsothattheplayercanberepsonsivecontext:"outstream",protocols:[2,3,7]},},bids:[{bidder:"spotx",params:{channel_id:,ad_unit:"outstream",outstream_function:spotxOutstreamFunc}},{bidder:'ix',params:{siteId:''}},],},{code:"div-gpt-ad-liputan6-lb",mediaTypes:{video:{playerSize:[970,250],//Notsetsothattheplayercanberepsonsivecontext:"outstream",protocols:[2,3,7]},},bids:[ {bidder:'ix',params:{siteId:''}},],},];pbjs.que=pbjs.que||[];googlet.cmd=googlet.cmd||[];/**END-PREBIDINIT,CONFIGURATION&GOOGLEINIT*//*PROTOTYPECUSTOMFILTERING*/String.prototype.klyFiltering=function(delimiter){returnthis.trim().split(delimiter).map(function(t){returnt.trim().toLowerCase()}).filter(x=>x!="");};window.GAMLibrary={};window.GAMLibrary={dfpBillboard:'//KLY/DESKTOP/LIPUTAN6.COM/MASTHEAD', gamImmersive:'//KLY/DESKTOP/LIPUTAN6.COM/IMMERSIVE', dfpSC:'//KLY/DESKTOP/LIPUTAN6.COM/SHOWCASE',dfpHalfpe1:'//KLY/DESKTOP/LIPUTAN6.COM/HALFPE_1',dfpHalfpe2:'//KLY/DESKTOP/LIPUTAN6.COM/HALFPE_2',dfpLeaderboard:'//KLY/DESKTOP/LIPUTAN6.COM/LEADERBOARD',userent:nigator.userent.toLowerCase(),GAMisTablet:/(ipad|tablet|(android(?!.*mobile))|(windows(?!.*phone)(.*touch))|kindle|playbook|silk|(puffin(?!.*(IP|AP|WP))))/.test(this.userent),ts:'',documentMeta:function(metaName){varmetaResult='';varmetas=document.getElementsByTName('meta');if(metas){for(varx=0,y=metas.length;x0){googlet.pubads().setTargeting("bsKeyword",bsKeyword);/*Temporarypreservethepreviousbrandsafetytargeting*/googlet.pubads().setTargeting("isMatcont",isMatcont);googlet.pubads().setTargeting("brandsafety",isViolateBrandSafety);}}}/*DMPCATEGORYLIST*/window.createDMPTracker=function(adsCatList,dfpTracker,macro){window.createCDPTracker(adsCatList,macro);parent.window.open(dfpTracker,'_blank');};window.createCDPTracker=function(cat,macro){varcName='ahoy_visitor=',cVisitorId=document.cookie.split(';').find(v=>{returnv.match(cName);}),partnerUID=cVisitorId?decodeURIComponent(cVisitorId).trim().replace(cName,''):0,gamMacro=typeofmacro==="string"?JSON.parse(macro):macro,defaultKey={adunitId:"ads_adunit_id",advertiserId:"ads_advertiser_id",creativeId:"ads_creative_id",lineitemId:"ads_lineitem_id",orderId:"ads_order_id",};actionDetails=Object.keys(gamMacro).reduce((obj,k)=>Object.assign(obj,defaultKey[k]?{[defaultKey[k]]:gamMacro[k]}:{[k]:gamMacro[k]}),{}),cdpData={action:actionDetails.action?actionDetails.action:'ads_click',action_category:cat,action_details:actionDetails.action?(deleteactionDetails.action,actionDetails=actionDetails):actionDetails,visitor_id:partnerUID};//partnerUID?window.VidioPersonalization.sendData(null,cdpData):'';//partnerUID?window.AhoyEvent.sendPersonalizationUserEvent(cdpData):'';(actionDetails.action=='ads_click')?(partnerUID?window.AhoyEvent.sendPersonalizationUserEvent(cdpData):''):'';};googlet.cmd.push(function(){varurlPath=document.URL;window.GAMLibrary.brandSafetyChecker();/*DEFINEIMMERSIVET-DONOTCHANGETHESLOTORDER,IMMERSIVEALWAYSONTHE1stPOSITION-*/vargam_immersive=googlet.defineOutOfPeSlot(GAMLibrary.gamImmersive,'div-gpt-ad-liputan6-immersive-oop').addService(googlet.pubads());window.GAMLibrary.showcase=googlet.defineSlot(GAMLibrary.dfpSC,[[300,250],[250,250]],'div-gpt-ad-liputan6-sc').addService(googlet.pubads());window.GAMLibrary.halfpe1=googlet.defineSlot(GAMLibrary.dfpHalfpe1,[[300,250],[300,600],[160,600]],'div-gpt-ad-liputan6-halfpe1').addService(googlet.pubads());window.GAMLibrary.halfpe2=googlet.defineSlot(GAMLibrary.dfpHalfpe2,[[300,250],[300,600],[160,600]],'div-gpt-ad-liputan6-halfpe2').addService(googlet.pubads());window.GAMLibrary.leaderboard=googlet.defineSlot(GAMLibrary.dfpLeaderboard,[[970,90],[728,90],[970,250]],'div-gpt-ad-liputan6-lb').addService(googlet.pubads()).setTargeting("leaderboard_type",['direct']);/*OUTOFPESLOT*/googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/BALLOON','div-gpt-ad-liputan6-balloon-oop').addService(googlet.pubads()); googlet.defineOutOfPeSlot('///dfp-headline1','div-gpt-ad-liputan6-dfp-headline1-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('///dfp-headline2','div-gpt-ad-liputan6-dfp-headline2-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/NEWS_T_1','div-gpt-ad-liputan6-newsT1-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/NEWS_T_2','div-gpt-ad-liputan6-newsT2-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/HEADLINE_CRM','div-gpt-ad-liputan6-crm-headline-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/ORGANIC_FEED_CRM_1','div-gpt-ad-liputan6-crm1-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/ORGANIC_FEED_CRM_2','div-gpt-ad-liputan6-crm2-oop').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/ORGANIC_FEED_CRM_3','div-gpt-ad-liputan6-crm3-oop').addService(googlet.pubads()); googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/ADVERTORIAL_HEADLINE_1','div-gpt-ad-liputan6-advertorial-headline1').addService(googlet.pubads());googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/ADVERTORIAL_HEADLINE_2','div-gpt-ad-liputan6-advertorial-headline2').addService(googlet.pubads());googlet.pubads().addEventListener('slotRenderEnded',function(event){vardfp_slotElementId=event.slot.getSlotId().getDomId();if(event.slot==gam_immersive){if(event.isEmpty){gam_billboard=googlet.defineOutOfPeSlot(GAMLibrary.dfpBillboard,'div-gpt-ad-liputan6-billboard-oop').addService(googlet.pubads());gam_topfrm=googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/TOP_FRAME','div-gpt-ad-liputan6-topfrm-oop').addService(googlet.pubads());gam_bottomfrm=googlet.defineSlot('//KLY/DESKTOP/LIPUTAN6.COM/BOTTOM_FRAME',[468,60],'div-gpt-ad-liputan6-bottomfrm-oop').addService(googlet.pubads());googlet.display('div-gpt-ad-liputan6-billboard-oop');googlet.display('div-gpt-ad-liputan6-topfrm-oop');googlet.display('div-gpt-ad-liputan6-bottomfrm-oop');if(!GAMLibrary.GAMisTablet){gam_skinad=googlet.defineOutOfPeSlot('//KLY/DESKTOP/LIPUTAN6.COM/SKINAD','div-gpt-ad-liputan6-skinad-oop').addService(googlet.pubads());googlet.display('div-gpt-ad-liputan6-skinad-oop');googlet.pubads().refresh([gam_billboard,gam_topfrm,gam_bottomfrm,gam_skinad]);}else{googlet.pubads().refresh([gam_billboard,gam_topfrm,gam_bottomfrm]);}}}});/*START-SENDIMPRESSIONDATATOCDP*/googlet.pubads().addEventListener('slotOnload',function(event){vardfp_slotDelivered=event.slot.getResponseInformation()?'block':'none';/*checkwheterthereisadsornot*/if(dfp_slotDelivered=='block'){cdpData={action:'ads_impression',action_details:{slotElementId:event.slot.getSlotElementId(),ResponseInformation:event.slot.getResponseInformation(),sizes:event.slot.getSizes(),adunitPath:event.slot.getAdUnitPath(),outOfPe:event.slot.getOutOfPe()}};window.AhoyEvent.sendPersonalizationUserEvent(cdpData);}});/*END-SENDIMPRESSIONDATATOCDP*//*STARTTARGETINGBLOCK*/googlet.pubads().setTargeting("ts",window.GAMLibrary.ts);googlet.pubads().setTargeting("currentUrl",urlPath); googlet.pubads().setTargeting("platform",kmklabs.platform);googlet.pubads().setTargeting("type",kmklabs.gtm.type);googlet.pubads().setTargeting("peType",kmklabs.peType);googlet.pubads().setTargeting("channel",kmklabs.gtm.subCategory);googlet.pubads().setTargeting("audience",kmklabs.gtm.audience.split("|"));googlet.pubads().setTargeting("isAdvertorial",typeof(isAdvertorial=kmklabs.article&&kmklabs.article.isAdvertorial.toString())==="undefined"?"false":isAdvertorial);googlet.pubads().setTargeting("isMultipe",typeof(isMultipe=kmklabs.article&&kmklabs.article.isMultipe.toString())==="undefined"?"false":isMultipe);googlet.pubads().setTargeting("articleId",kmklabs.gtm.articleId.toString());googlet.pubads().setTargeting("site",kmklabs.site);googlet.pubads().setTargeting("e",typeof(e=kmklabs.gtm.e)==="undefined"?"false":kmklabs.gtm.e.toString());googlet.pubads().setTargeting("gender",typeof(gender=kmklabs.gtm.gender)==="undefined"?"false":kmklabs.gtm.gender.toString());googlet.pubads().setTargeting("subcategory",kmklabs.gtm.subCategory);/*ENDTARGETINGBLOCK*//*SETVISITORIDASPUBLISHERPROVIDEDID-START*/varcVisitorId=(visId=document.cookie.split("ahoy_visitor")[1])?visId.split(';')[0].replace(/[^a-zA-Z0-9]/ig,''):false;if(cVisitorId){googlet.pubads().setPublisherProvidedId(cVisitorId+'kly');}/*SETVISITORIDASPUBLISHERPROVIDEDID-END*/googlet.pubads().setCentering(true);googlet.pubads().enableSingleRequest();googlet.pubads().collapseEmptyDivs();googlet.enableServices();}); /*INITIATEPREBID*/varprebidObject=newPrebidInstantiate(1000,3000,1000,adUnitsDisplay,adUnitsVideo,priceGranularityConfig);googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-immersive-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-sc');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-halfpe1');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-halfpe2');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-lb');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-balloon-oop');}); googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-dfp-headline1-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-dfp-headline2-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-newsT1-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-newsT2-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-crm-headline-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-crm1-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-crm2-oop');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-crm3-oop');}); googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-advertorial-headline1');});googlet.cmd.push(function(){googlet.display('div-gpt-ad-liputan6-advertorial-headline2');});

대지:Berita Terkini, Kabar Terbaru Hari Ini Indonesia dan Dunia - Liputan6.com보고서

사이트 위반 사항이있는 경우 신고를 클릭하세요.보고서

추천 정보

추천 사이트